Control Products
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Dysad; Dysadherin; FXYD 5; FXYD domain containing ion transport regulator 5; FXYD domain-containing ion transport regulator 5; Fxyd5; FXYD5_HUMAN; FXYD5RIC; HSPC 113; HSPC113; IWU 1; IWU1; KCT 1; KCT1; Keratinocytes associated transmembrane protein 1; OIT 2; OIT2; PRO 6241; PRO6241; RIC;
Immunogens
A synthesized peptide derived from human FXYD5.
- Q96DB9 FXYD5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSPSGRLCLLTIVGLILPTRGQTLKDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITGIIILTSGKCRQLSRLCRNRCR
Research Backgrounds
Involved in down-regulation of E-cadherin which results in reduced cell adhesion. Promotes metastasis.
Glycosylated.
Membrane>Single-pass type I membrane protein.
Belongs to the FXYD family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.