Product: FUNDC1 antibody
Catalog: DF15481
Description: Rabbit polyclonal antibody to FUNDC1
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse
Mol.Wt.: 17kD(Observed); 17kD(Calculated).
Uniprot: Q8IVP5

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, IF/ICC 1:100-1:500, WB 1:500-1:2000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse
Clonality:
Polyclonal
Specificity:
FUNDC1 antibody detects endogenous levels of FUNDC1.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

FUN14 domain containing 1; FUN14 domain containing protein 1; FUN14 domain-containing protein 1; FUND1_HUMAN; fundc1;

Immunogens

Immunogen:

A synthesized peptide derived from human FUNDC1.

Uniprot:
Gene(ID):
Expression:
Q8IVP5 FUND1_HUMAN:

Widely expressed.

Sequence:
MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS

Research Backgrounds

Function:

Acts as an activator of hypoxia-induced mitophagy, an important mechanism for mitochondrial quality control.

PTMs:

Phosphorylation at Tyr-18 by SRC inhibits activation of mitophagy. Following hypoxia, dephosphorylated at Tyr-18, leading to interaction with MAP1 LC3 family proteins and triggering mitophagy.

Subcellular Location:

Mitochondrion outer membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed.

Family&Domains:

The YXXL motif mediates the interaction with MAP1 LC3 family proteins MAP1LC3A, MAP1LC3B and GABARAP.

Belongs to the FUN14 family.

References

1). FUNDC1 deficiency aggravates endothelial senescence and retinal dysfunction. Biochimica et biophysica acta. Molecular basis of disease, 2026 (PubMed: 41135636) [IF=4.2]

2). Ginsenoside Rh1 Alleviates Allergic Rhinitis by Mediating Mitochondrial Autophagy via Activation of the AMPK/ULK1/FUNDC1 Pathway. Food science & nutrition, 2025 (PubMed: 40535916) [IF=3.5]

Application: WB    Species: Mouse    Sample:

FIGURE 3 Ginsenoside Rh1 activates the AMPK/ULK1/FUNDC1 pathway to enhance mitochondrial autophagy in AR mice. (A) Venn diagram illustrating the overlap between AR and the targets of Ginsenoside Rh1. (B) PPI network highlighting interactions among key targets, including AMPK (PRKAG1), ULK1, and FUNDC1. (C) GO analysis of the three biological ontologies. (D) The chemical structure of Ginsenoside Rh1. (E) MD of Ginsenoside Rh1 and AMPK. (F) WB analysis demonstrating protein levels of AMPK, ULK1, and FUNDC1, as well as their phosphorylated forms. (G) WB results showing the protein levels of PINK1 and Parkin. (H, I) IF detection of PINK1 and Parkin in the nasal mucosa. Data are presented as mean ± SD (n = 8). *p 

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.