IFITM5 Antibody - #DF15504
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Bone-restricted interferon-induced transmembrane protein-like protein; BRIL; Fragilis4; Hrmp1; IFITM5; IFM5_HUMAN; Interferon-induced transmembrane protein 5;
Immunogens
A synthesized peptide derived from human IFITM5.
Detected in bone (PubMed:24058703). Detected in osteoblasts and fibroblasts (at protein level) (PubMed:24519609). Detected in bone (PubMed:24058703). Detected in osteoblasts and fibroblasts (PubMed:24519609).
- A6NNB3 IFM5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADYD
Research Backgrounds
Required for normal bone mineralization.
Palmitoylated.
Cell membrane>Multi-pass membrane protein.
Detected in bone. Detected in osteoblasts and fibroblasts (at protein level). Detected in bone. Detected in osteoblasts and fibroblasts.
Belongs to the CD225/Dispanin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.