Product: LST1 Antibody
Catalog: DF15551
Description: Rabbit polyclonal antibody to LST1
Application: IF/ICC
Reactivity: Human
Mol.Wt.: 11kD(Calculated).
Uniprot: O00453

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
LST1 Antibody detects endogenous levels of LST1.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

B144; B144 protein; D6S49E; Leucocyte specific transcript 1; Leukocyte-specific transcript 1 protein; Liver Specific Transporter; LIVTR; LST 1; Lst1; LST1_HUMAN; lymphocyte antigen 117; MGC119006; MGC119007; OTTHUMP00000029390; OTTHUMP00000029391; OTTHUMP00000029392; OTTHUMP00000029396; OTTHUMP00000029397; OTTHUMP00000029398; OTTHUMP00000038208; OTTHUMP00000038211; OTTHUMP00000038213; OTTHUMP00000038312; OTTHUMP00000038314; OTTHUMP00000038315; OTTHUMP00000038651; OTTHUMP00000038655; OTTHUMP00000038657; OTTHUMP00000166011; OTTHUMP00000166014; OTTHUMP00000166016; OTTHUMP00000166017; OTTHUMP00000166018; OTTHUMP00000166019; OTTHUMP00000215143; Protein B144;

Immunogens

Immunogen:

A synthesized peptide derived from human LST1.

Uniprot:
Gene(ID):
Expression:
O00453 LST1_HUMAN:

Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain.

Sequence:
MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT

Research Backgrounds

Function:

Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.

Subcellular Location:

Membrane>Single-pass membrane protein. Golgi apparatus membrane>Single-pass membrane protein. Endomembrane system>Single-pass membrane protein.
Note: Also detected in a perinuclear region corresponding to the localization of the Golgi apparatus and throughout the cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain.

Family&Domains:

Belongs to the LST1 family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.