LST1 Antibody - #DF15551
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
B144; B144 protein; D6S49E; Leucocyte specific transcript 1; Leukocyte-specific transcript 1 protein; Liver Specific Transporter; LIVTR; LST 1; Lst1; LST1_HUMAN; lymphocyte antigen 117; MGC119006; MGC119007; OTTHUMP00000029390; OTTHUMP00000029391; OTTHUMP00000029392; OTTHUMP00000029396; OTTHUMP00000029397; OTTHUMP00000029398; OTTHUMP00000038208; OTTHUMP00000038211; OTTHUMP00000038213; OTTHUMP00000038312; OTTHUMP00000038314; OTTHUMP00000038315; OTTHUMP00000038651; OTTHUMP00000038655; OTTHUMP00000038657; OTTHUMP00000166011; OTTHUMP00000166014; OTTHUMP00000166016; OTTHUMP00000166017; OTTHUMP00000166018; OTTHUMP00000166019; OTTHUMP00000215143; Protein B144;
Immunogens
A synthesized peptide derived from human LST1.
Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain.
- O00453 LST1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT
Research Backgrounds
Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.
Membrane>Single-pass membrane protein. Golgi apparatus membrane>Single-pass membrane protein. Endomembrane system>Single-pass membrane protein.
Note: Also detected in a perinuclear region corresponding to the localization of the Golgi apparatus and throughout the cytoplasm.
Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain.
Belongs to the LST1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.