PRND Antibody - #DF15565
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
dJ1068H6.4; DPL; Dublet; MGC41841; Prion gene complex downstream; Prion like protein doppel; Prion protein 2 (dublet); Prion protein 2; Prion-like protein doppel; PRND; PRND_HUMAN; PrPLP;
Immunogens
A synthesized peptide derived from human PRND.
Expressed in testis, in Sertoli cells, ejaculated spermatozoa and in seminal fluid (at protein level).
- Q9UKY0 PRND_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRKHLSWWWLATVCMLLFSHLSAVQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLTVK
Research Backgrounds
Required for normal acrosome reaction and for normal male fertility (By similarity). Can bind Cu(2+).
N-glycosylated. N-glycosylated at two distinct sites.
O-glycosylated.
Cell membrane>Lipid-anchor.
Expressed in testis, in Sertoli cells, ejaculated spermatozoa and in seminal fluid (at protein level).
A short helical region is required and sufficient for Cu(2+) binding.
Belongs to the prion family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.