ZNF461 Antibody - #DF15587
| Product: | ZNF461 Antibody |
| Catalog: | DF15587 |
| Description: | Rabbit polyclonal antibody to ZNF461 |
| Application: | ELISA(peptide) |
| Reactivity: | Human |
| Mol.Wt.: | 66kD(Calculated). |
| Uniprot: | Q8TAF7 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
GIOT-1; GIOT1; Gonadotropin inducible ovary transcription repressor 1; Gonadotropin inducible transcription repressor 1; Gonadotropin-inducible ovary transcription repressor 1; Zinc finger protein 461; ZN461_HUMAN; ZNF461;
Immunogens
A synthesized peptide derived from human ZNF461.
Widely expressed, with highest levels in liver, kidney, pancreas, thymus, and small intestine.
- Q8TAF7 ZN461_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAHELVMFRDVAIDVSQEEWECLNPAQRNLYKEVMLENYSNLVSLGLSVSKPAVISSLEQGKEPWMVVREETGRWCPGTWKTWGFHNNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKELSECKECTEIVNTPCLFKQQTIQNGDKCNECKECWKAFVHCSQLKHLRIHNGEKRYECNECGKAFNYGSELTLHQRIHTGEKPYECKECGKAFRQRSQLTQHQRLHTGEKPYECKQCGKAFIRGFQLTEHLRLHTGEKPYECKECGKTFRHRSHLTIHQRIHTGEKPYECRECGKAFSYHSSFSHHQKIHSGKKPYECHECGKAFCDGLQLTLHQRIHTGEKPYECKECGKTFRQCSHLKRHQRIHTGEKPHECMICGKAFRLHSHLIQHQRIHTGEKPYECKECGKAFSYHSSFSHHQRIHSGKKPYQCGKAFNHRLQLNLHQTLHTGEKPVRFPLLPPHPSLAS
Research Backgrounds
May be involved in transcriptional regulation.
Nucleus.
Widely expressed, with highest levels in liver, kidney, pancreas, thymus, and small intestine.
Belongs to the krueppel C2H2-type zinc-finger protein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.