BEX1 Antibody - #DF15606
| Product: | BEX1 Antibody |
| Catalog: | DF15606 |
| Description: | Rabbit polyclonal antibody to BEX1 |
| Application: | ELISA(peptide) |
| Reactivity: | Human |
| Mol.Wt.: | 15kD(Calculated). |
| Uniprot: | Q9HBH7 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
BEX2; Brain expressed X linked 1; HBEX2; Protein BEX1; Reduced expression protein 3; REX 3; REX3;
Immunogens
A synthesized peptide derived from human BEX1.
Expressed in central nervous system, with high level in pituitary, cerebellum and temporal lobe. Expressed in lung, skeletal muscle, peripheral blood leukocyte, stomach, lymph node, trachea and bone marrow. Highly expressed in acute myeloid leukemia.
- Q9HBH7 BEX1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP
Research Backgrounds
Signaling adapter molecule involved in p75NTR/NGFR signaling. Plays a role in cell cycle progression and neuronal differentiation. Inhibits neuronal differentiation in response to nerve growth factor (NGF). May act as a link between the cell cycle and neurotrophic factor signaling, possibly by functioning as an upstream modulator of receptor signaling, coordinating biological responses to external signals with internal cellular states (By similarity).
Phosphorylated. Phosphorylation of Ser-102 protects it from the proteasome (By similarity).
Ubiquitinated. Degraded by the proteasome (By similarity).
Nucleus. Cytoplasm.
Note: Shuttles between the cytoplasm and the nucleus.
Expressed in central nervous system, with high level in pituitary, cerebellum and temporal lobe. Expressed in lung, skeletal muscle, peripheral blood leukocyte, stomach, lymph node, trachea and bone marrow. Highly expressed in acute myeloid leukemia.
Belongs to the BEX family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.