RBP7 Antibody - #DF15653
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Cellular retinoic acid binding protein 4; Cellular retinoic acid-binding protein 4; Cellular retinoic acid-binding protein IV; CRABP IV; CRABP-IV; CRABP4; CRBP4; CRBPIV; Putative cellular retinol-binding protein CRBP IV; Rbp7; RET7_HUMAN; Retinoid binding protein 7; Retinoid-binding protein 7; Retinol binding protein 7, cellular;
Immunogens
A synthesized peptide derived from human RBP7.
Expressed primarily in kidney, heart and transverse colon. Detected in adult lymph node, appendix, ascending colon, and in fetal heart and spleen.
- Q96R05 RET7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA
Research Backgrounds
Intracellular transport of retinol.
Cytoplasm.
Expressed primarily in kidney, heart and transverse colon. Detected in adult lymph node, appendix, ascending colon, and in fetal heart and spleen.
Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.