VMA21 Antibody - #DF15661
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
MEAX; Myopathy with excessive autophagy protein; Vacuolar ATPase assembly integral membrane protein VMA21; VMA21; XMEA;
Immunogens
A synthesized peptide derived from human VMA21.
- Q3ZAQ7 VMA21_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD
Research Backgrounds
Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Endoplasmic reticulum membrane>Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane>Multi-pass membrane protein. Cytoplasmic vesicle>COPII-coated vesicle membrane>Multi-pass membrane protein.
Belongs to the VMA21 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.