BRK1 Antibody - #DF15680
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
BRICK1, SCAR/WAVE actin nucleating complex subunit; BRICK1, SCAR/WAVE actin nucleating complex subunit, homolog; BRK1; Brk1-like; C3orf10 chromosome 3 open reading frame 10; C3ORF10 GENE; Chromosome 3 open reading frame 10; Haematopoietic stem/progenitor cell protein 300; hHBrk1; HSPC300; MDS027; Probable protein BRICK1; Protein BRICK1;
Immunogens
A synthesized peptide derived from human BRK1.
- Q8WUW1 BRK1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT
Research Backgrounds
Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (By similarity).
Cytoplasm>Cytoskeleton.
Belongs to the BRK1 family.
Research Fields
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.