DNAJC24 Antibody - #DF15749
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
1700030A21Rik; 2610027M02Rik; AV066965; AW240712; CSL type zinc finger containing protein 3; CSL-type zinc finger-containing protein 3; DJC24_HUMAN; DnaJ (Hsp40) homolog, subfamily C, member 24; DnaJ homolog subfamily C member 24; DNAJC24; DPH4 homolog (JJJ3, S. cerevisiae); DPH4 homolog; DPH4, JJJ3 homolog; JJJ3; MmDjC7; RGD1564710; RP23-232D1.6; ZCSL3; Zinc finger, CSL domain containing 3; Zinc finger, CSL type containing 3;
Immunogens
A synthesized peptide derived from human DNAJC24.
- Q6P3W2 DJC24_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN
Research Backgrounds
Stimulates the ATPase activity of several Hsp70-type chaperones. This ability is enhanced by iron-binding. The iron-bound form is redox-active and can function as electron carrier. Plays a role in the diphthamide biosynthesis, a post-translational modification of histidine which occurs in translation elongation factor 2 (EEF2) which can be ADP-ribosylated by diphtheria toxin and by Pseudomonas exotoxin A (Eta).
Cytoplasm>Cytoskeleton.
The DPH-type metal-binding (MB) domain can bind either zinc or iron ions.
Belongs to the DPH4 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.