MARCH2 Antibody - #DF15760
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
E3 ubiquitin protein ligase MARCH2; E3 ubiquitin-protein ligase MARCH2; EC 6.3.2.-; HSPC240; MARCH 2; MARCH II; MARCH-II; march2; MARH2_HUMAN; Membrane associated RING CH protein II; Membrane associated ring finger (C3HC4) 2; Membrane associated RING finger protein 2; Membrane-associated RING finger protein 2; Membrane-associated RING-CH protein II; RING finger protein 172; RNF172;
Immunogens
A synthesized peptide derived from human MARCH2.
- Q9P0N8 MARH2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV
Research Backgrounds
E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6.
Endoplasmic reticulum membrane>Multi-pass membrane protein. Lysosome membrane>Multi-pass membrane protein. Endosome membrane>Multi-pass membrane protein.
Broadly expressed.
Interacts with STX6 (By similarity). Interacts with MARCHF3.
The RING-CH-type zinc finger domain is required for E3 ligase activity.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.