OLFM3 Antibody - #DF15761
| Product: | OLFM3 Antibody |
| Catalog: | DF15761 |
| Description: | Rabbit polyclonal antibody to OLFM3 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 55kD(Calculated). |
| Uniprot: | Q96PB7 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Noe3; NOE3_HUMAN; Noelin 3; Noelin-3; NOELIN3; NOELIN3 V1; NOELIN3 V2; NOELIN3 V3; NOELIN3 V4; NOELIN3 V5; NOELIN3 V6; Olfactomedin 3; Olfactomedin related ER localized protein 3; Olfactomedin-3; Olfactomedin3; Olfm3; Optimedin; OTTHUMP00000012614;
Immunogens
A synthesized peptide derived from human OLFM3.
In the eye, expressed in trabecular meshwork and neural retina; in non-ocular tissues, expressed in brain and lung.
- Q96PB7 NOE3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPDTLTQISPKEGWQVYSSAQDPDGRCICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQMKGLKAKFRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSAVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKITGPVTVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNGSLYFNKYQSNIIIKYSFDMGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVYATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSYSTKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNVTLFHIIKTEDDT
Research Backgrounds
Secreted. Cell junction>Synapse.
In the eye, expressed in trabecular meshwork and neural retina; in non-ocular tissues, expressed in brain and lung.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.