TRAT1 Antibody - #DF15785
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
HSPC062; pp29/30; T cell receptor interacting molecule; T-cell receptor-associated transmembrane adapter 1; T-cell receptor-interacting molecule; TCRIM; TRAT1; TRAT1_HUMAN; TRIM;
Immunogens
A synthesized peptide derived from human TRAT1.
Strongly expressed in thymus, and to a lesser extent in spleen, lymph node and peripheral blood lymphocytes. Present in T-cells and NK cells, but not B-cells (at protein level).
- Q6PIZ9 TRAT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGISGCPFFLWGLLALLGLALVISLIFNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN
Research Backgrounds
Stabilizes the TCR (T-cell antigen receptor)/CD3 complex at the surface of T-cells.
Phosphorylated on tyrosines by LCK or FYN upon TCR activation.
Cell membrane>Single-pass type III membrane protein.
Strongly expressed in thymus, and to a lesser extent in spleen, lymph node and peripheral blood lymphocytes. Present in T-cells and NK cells, but not B-cells (at protein level).
Homodimer; disulfide-linked. Interacts with CD3Z. When phosphorylated, interacts with PIK3R1.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.