DUSP18 Antibody - #DF15790
Product: | DUSP18 Antibody |
Catalog: | DF15790 |
Description: | Rabbit polyclonal antibody to DUSP18 |
Application: | ELISA(peptide) |
Reactivity: | Human, Rat |
Mol.Wt.: | 21kD(Calculated). |
Uniprot: | Q8NEJ0 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Dual specificity protein phosphatase 18; DUS18_HUMAN; Dusp18; LMW-DSP20; LMWDSP20; Low molecular weight dual specificity phosphatase 20;
Immunogens
A synthesized peptide derived from human DUSP18.
- Q8NEJ0 DUS18_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL
Research Backgrounds
Can dephosphorylate single and diphosphorylated synthetic MAPK peptides, with preference for the phosphotyrosine and diphosphorylated forms over phosphothreonine. In vitro, dephosphorylates p-nitrophenyl phosphate (pNPP).
Cytoplasm. Nucleus. Mitochondrion inner membrane>Peripheral membrane protein>Intermembrane side.
Note: Translocates to cytoplasm in response to apoptotic stimuli such as staurosporine treatment.
Widely expressed with highest levels in liver, brain, ovary and testis.
Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.