CLDND1 Antibody - #DF15798
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
C3orf4; Chromosome 3 open reading frame 4; Claudin domain containing 1; Claudin domain containing 1 protein; GENX 3745; Membrane protein GENX3745; MGC111162; MGC3316; MGC9861; OTTHUMP00000217407; OTTHUMP00000217408; OTTHUMP00000217423; OTTHUMP00000217424; OTTHUMP00000217562; OTTHUMP00000217563; OTTHUMP00000217584; OTTHUMP00000217585; OTTHUMP00000217586; OTTHUMP00000217587; OTTHUMP00000217609; OTTHUMP00000217610; OTTHUMP00000217611; OTTHUMP00000217622; OTTHUMP00000217623; OTTHUMP00000217625; OTTHUMP00000217627; OTTHUMP00000217628; OTTHUMP00000217638;
Immunogens
A synthesized peptide derived from human CLDND1.
Widely distributed in the adult CNS with highest expression in the corpus callosum, caudate nucleus, cerebral cortex, medulla, putamen, spinal cord, substantia nigra and subthalamic nucleus. Weak expression was detected in the adult heart.
- Q9NY35 CLDN1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA
Research Backgrounds
Membrane>Multi-pass membrane protein.
Widely distributed in the adult CNS with highest expression in the corpus callosum, caudate nucleus, cerebral cortex, medulla, putamen, spinal cord, substantia nigra and subthalamic nucleus. Weak expression was detected in the adult heart.
Belongs to the PMP-22/EMP/MP20 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.