TMEM230 Antibody - #DF15803
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
C20orf30; Chromosome 20 open reading frame 30; CT030_HUMAN; dJ1116H23.2.1; HSPC274; Hypothetical protein LOC29058; OTTHUMP00000030179; OTTHUMP00000030181; OTTHUMP00000030182; OTTHUMP00000030183; OTTHUMP00000030184; OTTHUMP00000030185; OTTHUMP00000030186; OTTHUMP00000030187; RP5-1116H23.2; UPF0414 transmembrane protein C20orf30;
Immunogens
A synthesized peptide derived from human TMEM230.
- Q96A57 TM230_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
Research Backgrounds
Involved in trafficking and recycling of synaptic vesicles.
Membrane>Multi-pass membrane protein. Golgi apparatus>trans-Golgi network. Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle. Early endosome. Recycling endosome. Late endosome. Cytoplasmic vesicle>Autophagosome.
Belongs to the TMEM134/TMEM230 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.