EURL Antibody - #DF15807
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
C21orf14; C21orf38; C21orf7; C21orf91; Chromosome 21 open reading frame 38; Chromosome 21 open reading frame 91; Early undifferentiated retina and lens; EURL; Protein EURL homolog; YG81;
Immunogens
A synthesized peptide derived from human EURL.
Expressed in the brain (PubMed:27404227). Expressed in cortical cells of the germinal ventricular zone and the cortical plate. Underexpressed in the dorsolateral prefrontal cortex, primary visual cortex and cerebellar cortex compared with Down Syndrome patients (at protein level) (PubMed:27404227).
- Q9NYK6 EURL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNEEEQFVNIDLNDDNICSVCKLGTDKETLSFCHICFELNIEGVPKSDLLHTKSLRGHKDCFEKYHLIANQGCPRSKLSKSTYEEVKTILSKKINWIVQYAQNKDLDSDSECSKNPQHHLFNFRHKPEEKLLPQFDSQVPKYSAKWIDGSAGGISNCTQRILEQRENTDFGLSMLQDSGATLCRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVEQLNAKLLQQIQEVFEELTHQVQEKDSLASQLHVRHVAIEQLLKNCSKLPCLQVGRTGMKSHLPINN
Research Backgrounds
Plays a role in cortical progenitor cell proliferation and differentiation. Promotes dendritic spine development of post-migratory cortical projection neurons by modulating the beta-catenin signaling pathway.
Expressed in the brain. Expressed in cortical cells of the germinal ventricular zone and the cortical plate. Underexpressed in the dorsolateral prefrontal cortex, primary visual cortex and cerebellar cortex compared with Down Syndrome patients (at protein level).
Interacts with CCDC85B.
Belongs to the EURL family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.