ASCL4 Antibody - #DF15820

Product: | ASCL4 Antibody |
Catalog: | DF15820 |
Description: | Rabbit polyclonal antibody to ASCL4 |
Application: | ELISA(peptide) |
Reactivity: | Human |
Mol.Wt.: | 19kD(Calculated). |
Uniprot: | Q6XD76 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Achaete scute complex homolog 4 (Drosophila); Achaete scute complex like 4; Achaete scute like protein 4; bHLHa44; Class II bHLH protein ASCL4; HASH4;
Immunogens
A synthesized peptide derived from human ASCL4.
Expressed in skin. 7-fold higher expression in fetal skin than in adult skin. Weak expression also detected in fetal lung, aorta and brain, and in adult stomach, kidney, ovary and breast.
- Q6XD76 ASCL4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFEPAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLERQAWGLEGAAGAVPQRRAECNSDGESKASSAPSPSSEPEEGGS
Research Backgrounds
Could be a transcriptional regulator involved in skin development.
Nucleus.
Expressed in skin. 7-fold higher expression in fetal skin than in adult skin. Weak expression also detected in fetal lung, aorta and brain, and in adult stomach, kidney, ovary and breast.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.