FKBP1B Antibody - #DF15840
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
12.6 kDa FK506-binding protein; 12.6 kDa FKBP; Calstabin 2; FK506 binding protein 1 like; FK506 binding protein 12.6; FK506 binding protein 1B 12.6 kDa; FK506 binding protein 1B; FK506-binding protein 1B; FKB1B_HUMAN; FKBP 12.6; FKBP 1B; FKBP 1L; FKBP 9; FKBP-12.6; FKBP-1B; FKBP12.6; Fkbp1b; FKBP1L; FKBP9; h FKBP 12; h-FKBP-12; Immunophilin FKBP12.6; OTK 4; OTK4; Peptidyl prolyl cis trans isomerase 1B; Peptidyl prolyl cis trans isomerase; Peptidyl-prolyl cis-trans isomerase FKBP1B; PKBP 1L; PKBP1L; PPIase 1B; PPIase; PPIase FKBP1B; Rotamase 1B; Rotamase;
Immunogens
A synthesized peptide derived from human FKBP1B.
Detected in heart muscle (at protein level). Isoform 1 and isoform 2 are ubiquitous with highest levels in brain and thymus.
- P68106 FKB1B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Research Backgrounds
Has the potential to contribute to the immunosuppressive and toxic effects of FK506 and rapamycin. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Cytoplasm. Sarcoplasmic reticulum.
Detected in heart muscle (at protein level). Isoform 1 and isoform 2 are ubiquitous with highest levels in brain and thymus.
Belongs to the FKBP-type PPIase family. FKBP1 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.