SCML1 Antibody - #DF15869
| Product: | SCML1 Antibody |
| Catalog: | DF15869 |
| Description: | Rabbit polyclonal antibody to SCML1 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 37kD(Calculated). |
| Uniprot: | Q9UN30 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Gm1792; Gm47; OTTHUMP00000022996; OTTHUMP00000025692; RP3-389A20.1; SCML1; SCML1_HUMAN; Sex comb on midleg (Drosophila) like 1; Sex comb on midleg like 1 (Drosophila); Sex comb on midleg like 1; Sex comb on midleg like protein 1; Sex comb on midleg-like protein 1; Vsex comb on midleg like 1;
Immunogens
A synthesized peptide derived from human SCML1.
- Q9UN30 SCML1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMSNSSSEIDVIKTRIPTYDEDDNTILYAYETKPEFVNKEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNLDKKIDVIRRKVSKIQRFHARSLWTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVLLKHLGVKLGTAVKLCYYIDRLKQGKCFEN
Research Backgrounds
Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation (By similarity).
Nucleus.
Ubiquitous. Expressed in fetal and adult tissues.
Belongs to the SCM family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.