TREX2 Antibody - #DF15876
Product: | TREX2 Antibody |
Catalog: | DF15876 |
Description: | Rabbit polyclonal antibody to TREX2 |
Application: | ELISA(peptide) |
Reactivity: | Human |
Mol.Wt.: | 26kD(Calculated). |
Uniprot: | Q9BQ50 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
3' 5' exonuclease; 3' 5' exonuclease TREX2; 3'-5' exonuclease TREX2; Three prime repair exonuclease 2; TREX 2; TREX2; TREX2_HUMAN;
Immunogens
A synthesized peptide derived from human TREX2.
Detected in heart, breast, prostate, skeletal muscle, testis, uterus, bone marrow, colon, small intestine, stomach and thymus.
- Q9BQ50 TREX2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEA
Research Backgrounds
Exonuclease with a preference for double-stranded DNA with mismatched 3' termini. May play a role in DNA repair.
Nucleus.
Detected in heart, breast, prostate, skeletal muscle, testis, uterus, bone marrow, colon, small intestine, stomach and thymus.
Belongs to the exonuclease superfamily. TREX family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.