OCC1 Antibody - #DF15879
| Product: | OCC1 Antibody |
| Catalog: | DF15879 |
| Description: | Rabbit polyclonal antibody to OCC1 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 6kD(Calculated). |
| Uniprot: | Q8TAD7 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
Adipogenesis down regulated 3; AGD3; C12orf75; Chromosome 12 open reading frame 75; Hypothetical protein LOC387882; MGC148100; MGC149157; OCC 1; OCC-1; OCC1; OCC1_HUMAN; Overexpressed in colon carcinoma 1; Overexpressed in colon carcinoma 1 protein; Putative overexpressed in colon carcinoma 1 protein;
Immunogens
A synthesized peptide derived from human OCC1.
High expression in placenta, skeletal muscle, kidney and pancreas tissues. Absent or very faint expression in heart, brain, lung and liver. Expressed during adipogenic differentiation of mesenchymal stem cells (at protein level).
- Q8TAD7 OCC1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN
Research Backgrounds
High expression in placenta, skeletal muscle, kidney and pancreas tissues. Absent or very faint expression in heart, brain, lung and liver. Expressed during adipogenic differentiation of mesenchymal stem cells (at protein level).
Belongs to the OCC1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.