DPCR1 Antibody - #DF15886
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
bCX105N19.6; Diffuse panbronchiolitis critical region 1; Diffuse panbronchiolitis critical region; Diffuse panbronchiolitis critical region protein 1; DKFZp666O235; DPCR protein; DPCR1; DPCR1_HUMAN; MGC126710; MGC126712; OTTHUMP00000062447; PBLT;
Immunogens
A synthesized peptide derived from human DPCR1.
Detected in lung, esophagus, stomach, rectum, skin, cervix, testis, kidney, uterus and small intestine (PubMed:12185533). Expressed in pancreas (at protein level) (PubMed:29242154).
- Q3MIW9 MUCL3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAQPVHSLCSAFGLQCCLLFLLASWGAGATTFQEYQKTGELSTSDHIFPLTPGLVYSIPFDHIVLHSGQRPPELPKSTEIHEQKRHCNTTRHSKPTDKPTGNSKTIDHKSSTDNHEAPPTSEENSSNQGKDPMIRNQRSVDPADSTTTHKESAGKKHITPAPKSKINCRKSTTGKSTVTRKSDKTGRPLEKSMSTLDKTSTSSHKTTTSFHNSGNSQTKQKSTSFPEKITAASKTTYKTTGTPEESEKTEDSRTTVASDKLLTKTTKNIQETISANELTQSLAEPTEHGGRTANENNTPSPAEPTENRERTANENKKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKGIHAGQMGENDSFPAWAIVIVVLVAVILLLVFLGLIFLVSYMMRTRRTLTQNTQYNDAEDEGGPNSYPVYLMEQQNLGMGQIPSPR
Research Backgrounds
May modulate NF-kappaB signaling and play a role in cell growth.
Cell membrane>Single-pass type I membrane protein. Cytoplasm.
Detected in lung, esophagus, stomach, rectum, skin, cervix, testis, kidney, uterus and small intestine. Expressed in pancreas (at protein level).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.