TSPAN2 Antibody - #DF15896
| Product: | TSPAN2 Antibody |
| Catalog: | DF15896 |
| Description: | Rabbit polyclonal antibody to TSPAN2 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 24kD(Calculated). |
| Uniprot: | O60636 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
6330415F13Rik; AW048009; B230119D02Rik; FLJ12082; OTTHUMP00000013651; RP4-666F24.2; Tetraspan 2; Tetraspan TM4SF; Tetraspanin 2; Tetraspanin2; TSN2; Tspan 2;
Immunogens
A synthesized peptide derived from human TSPAN2.
- O60636 TSN2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGRFRGGLRCIKYLLLGFNLLFWLAGSAVIAFGLWFRFGGAIKELSSEDKSPEYFYVGLYVLVGAGALMMAVGFFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQLIGIVGIGIAGLTIFGMIFSMVLCCAIRNSRDVI
Research Backgrounds
May play a role in signalling in oligodendrocytes in the early stages of their terminal differentiation into myelin-forming glia and may also function in stabilizing the mature sheath.
Membrane>Multi-pass membrane protein.
Belongs to the tetraspanin (TM4SF) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.