DNAJC9 Antibody - #DF15930
| Product: | DNAJC9 Antibody |
| Catalog: | DF15930 |
| Description: | Rabbit polyclonal antibody to DNAJC9 |
| Application: | ELISA(peptide) |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 30kD(Calculated). |
| Uniprot: | Q8WXX5 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
DnaJ homolog subfamily C member 9; DnaJ Hsp40 homolog subfamily C member 9; DnaJ protein SB73; DNAJC9; DNJC9_HUMAN; HDJC9; J DOMAIN OF DNAJ LIKE PROTEIN 1; JDD1; SB73;
Immunogens
A synthesized peptide derived from human DNAJC9.
Expressed in heart, placenta, liver, skeletal muscle, kidney, pancreas, thymus, ovary, colon and peripheral blood.
- Q8WXX5 DNJC9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK
Research Backgrounds
May play a role as co-chaperone of the Hsp70 family proteins HSPA1A, HSPA1B and HSPA8.
Nucleus. Cytoplasm. Cell membrane.
Note: Predominantly nuclear. Translocates to the cytoplasm and membrane after heat shock.
Expressed in heart, placenta, liver, skeletal muscle, kidney, pancreas, thymus, ovary, colon and peripheral blood.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.