VPREB3 Antibody - #DF15982
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
N27C7 2; N27C7-2; Pre B lymphocyte protein 3; Pre-B lymphocyte protein 3; PRO619; Protein VPreB3; UNQ355; VPRE3_HUMAN; VPREB3; VpreB3 protein;
Immunogens
A synthesized peptide derived from human VPREB3.
Expressed in B-cell precursors. Expressed in fetal liver, bone marrow, spleen and lymph node.
- Q9UKI3 VPRE3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
Research Backgrounds
Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells.
Expressed in B-cell precursors. Expressed in fetal liver, bone marrow, spleen and lymph node.
Belongs to the immunoglobulin superfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.