Product: MDFIC Antibody
Catalog: DF16029
Description: Rabbit polyclonal antibody to MDFIC
Application: IHC
Reactivity: Human, Mouse
Mol.Wt.: 26kD(Calculated).
Uniprot: Q9P1T7

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
MDFIC Antibody detects endogenous levels of MDFIC.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

HIC; Human I mfa domain containing protein; Human I-mfa domain-Containing protein; I mfa domain containing protein; MyoD family inhibitor domain containing protein; MyoD family inhibitor domain-containing protein; p32; p40;

Immunogens

Immunogen:

A synthesized peptide derived from human MDFIC.

Uniprot:
Gene(ID):
Expression:
Q9P1T7 MDFIC_HUMAN:

Expressed in lymphoid organs (spleen, thymus, peripheral blood leukocytes) as well as prostate, uterus and small intestine.

Sequence:
MSGAGEALAPGPVGPQRVAEAGGGQLGSTAQGKCDKDNTEKDITQATNSHFTHGEMQDQSIWGNPSDGELIRTQPQRLPQLQTSAQVPSGEEIGKIKNGHTGLSNGNGIHHGAKHGSADNRKLSAPVSQKMHRKIQSSLSVNSDISKKSKVNAVFSQKTGSSPEDCCVHCILACLFCEFLTLCNIVLGQASCGICTSEACCCCCGDEMGDDCNCPCDMDCGIMDACCESSDCLEICMECCGICFPS

Research Backgrounds

Function:

Acts as a transcriptional activator or repressor. Inhibits the transcriptional activation of Zic family proteins ZIC1, ZIC2 and ZIC3. Retains nuclear Zic proteins ZIC1, ZIC2 and ZIC3 in the cytoplasm. Modulates the expression from both cellular and viral promoters. Down-regulates Tat-dependent transcription of the human immunodeficiency virus type 1 (HIV-1) LTR by interacting with HIV-1 Tat and Rev and impairing their nuclear import, probably by rendering the NLS domains inaccessible to importin-beta. Also stimulates activation of human T-cell leukemia virus type I (HTLV-I) LTR. Binds to the axin complex, resulting in an increase in the level of free beta-catenin. Affects axin regulation of the WNT and JNK signaling pathways.

Subcellular Location:

Nucleus>Nucleolus.
Note: Also shows a granular distribution in the cytoplasm.

Cytoplasm.
Note: Weak expression in the nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in lymphoid organs (spleen, thymus, peripheral blood leukocytes) as well as prostate, uterus and small intestine.

Subunit Structure:

Interacts with HAND1; leading to sequester HAND1 into the nucleolus and prevent its activity. Interacts with ZIC2 (By similarity). The C-terminus interacts with AXIN1, the histidine-rich region of CCNT1/cyclin-T and weakly with LEF1. Interacts with CCNT2.

(Microbial infection) Interacts (via C-terminus) with HIV-1 Tat and Rev.

Family&Domains:

The C2H2-type 3, 4 and 5 zinc finger domains are necessary for transcription activation (By similarity). The cysteine-rich C-terminus is involved in its granular distribution in the cytoplasm.

Belongs to the MDFI family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.