Product: LRRC3B Antibody
Catalog: DF16048
Description: Rabbit polyclonal antibody to LRRC3B
Application: WB IHC
Cited expt.: WB
Reactivity: Human, Mouse
Mol.Wt.: 29kD(Calculated).
Uniprot: Q96PB8

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, WB 1:500-1:2000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
LRRC3B Antibody detects endogenous levels of LRRC3B.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Leucine rich repeat containing 3B; Leucine-rich repeat protein LRP15; Leucine-rich repeat-containing protein 3B; LRC3B_HUMAN; LRRC3B; MGC102927;

Immunogens

Immunogen:

A synthesized peptide derived from human LRRC3B.

Uniprot:
Gene(ID):
Sequence:
MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV

Research Backgrounds

Subcellular Location:

Membrane>Single-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the LRRC3 family.

References

1). LRRC3B and its promoter hypomethylation status predicts response to anti-PD-1 based immunotherapy. Frontiers in Immunology, 2023 (PubMed: 36798137) [IF=5.7]

Application: WB    Species: Human    Sample: B2B and Hs578T cell

Figure 2 LRRC3B variants, localization, and expression profile under physiological conditions. (A) The LRRC3B protein topology revealed extracellular membrane localization with PTMs. (B) The LRRC3B-associated disease network. (C) Boxplots showing differential LRRC3B expression levels (log CPM+1) between tumor and adjacent normal tissues across the TCGA database. (D) Real-time RT-PCR analysis of LRRC3B mRNA in H1299 and Hs578T cell lines. (E) Protein levels of LRRC3B in B2B and H1299 cell lines assessed by immunoblot. (F) Protein levels of LRRC3B in B2B and Hs578T cell lines assessed by immunoblot. LRRC3B: leucine rich repeat containing 3B; PTMs: protein post-translational modifications; TCGA: The Cancer Genome Atlas.

Application: IF/ICC    Species: Human    Sample: lung cancer tissues

Figure 5 Multiplex IHC images of lung cancer tissues with immune cell biomarkers and LRRC3B expression. mIHC: multiplex immunofluorescence staining; LRRC3B: leucine rich repeat containing 3B.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.