Product: hnRNP A1 Mouse Monoclonal Antibody
Catalog: BF8054
Description: Mouse monoclonal antibody to hnRNP A1
Application: WB IHC
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Sheep, Dog, Chicken, Xenopus
Mol.Wt.: 33 KD; 39kD(Calculated).
Uniprot: P09651

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:1000-1:10000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Monoclonal [AFfirm8054]
Specificity:
hnRNP A1 Antibody detects endogenous levels of total hnRNP A1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

HNRNPA 1; Helix destabilizing protein; Helix-destabilizing protein; Heterogeneous nuclear ribonucleoprotein A1; Heterogeneous nuclear ribonucleoprotein A1B protein; Heterogeneous nuclear ribonucleoprotein B2 protein; Heterogeneous nuclear ribonucleoprotein core protein A1; hnRNP A1; hnRNP core protein A1; HNRNPA1; HNRPA1; MGC102835; Nuclear ribonucleoprotein particle A1 protein; ROA1_HUMAN; Single strand DNA binding protein UP1; Single strand RNA binding protein; Single-strand RNA-binding protein;

Immunogens

Immunogen:

A synthesized peptide derived from human hnRNP A1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF

Research Backgrounds

Function:

Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. May bind to specific miRNA hairpins. Binds to the IRES and thereby inhibits the translation of the apoptosis protease activating factor APAF1.

(Microbial infection) May play a role in HCV RNA replication.

(Microbial infection) Cleavage by Enterovirus 71 protease 3C results in increased translation of apoptosis protease activating factor APAF1, leading to apoptosis.

PTMs:

Arg-194, Arg-206 and Arg-225 are dimethylated, probably to asymmetric dimethylarginine.

Sumoylated.

Subcellular Location:

Nucleus. Cytoplasm.
Note: Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Shuttles continuously between the nucleus and the cytoplasm along with mRNA. Component of ribonucleosomes (PubMed:17289661).

Cytoplasm.
Note: (Microbial infection) In the course of viral infection, colocalizes with HCV NS5B at speckles in the cytoplasm in a HCV-replication dependent manner.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

Research Fields

· Genetic Information Processing > Transcription > Spliceosome.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.