AFfirm™ OLR1 Mouse Monoclonal Antibody - #BF8072
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
C-type lectin domain family 8 member A; CLEC8A; hLOX 1; hLOX-1; Lectin like oxidized LDL receptor 1; Lectin like oxLDL receptor 1; Lectin type oxidized LDL receptor 1; Lectin-like oxidized LDL receptor 1; Lectin-like oxLDL receptor 1; Lectin-type oxidized LDL receptor 1; low density lipoprotein oxidized, receptor 1; LOX-1; LOXIN; Olr1; OLR1_HUMAN; Ox LDL receptor 1; Ox-LDL receptor 1; Oxidised low density lipoprotein (lectin like) receptor 1; Oxidized low density lipoprotein receptor 1; Oxidized low density lipoprotein receptor 1 soluble form; Oxidized low-density lipoprotein receptor 1; SCARE1; Scavenger receptor class E, member 1; SLOX1; soluble form; SR-EI;
Immunogens
A synthesized peptide derived from human OLR1, corresponding to a region within N-terminal amino acids.
Expressed at high level in endothelial cells and vascular-rich organs such as placenta, lung, liver and brain, aortic intima, bone marrow, spinal cord and substantia nigra. Also expressed at the surface of dendritic cells. Widely expressed at intermediate and low level.
- P78380 OLR1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
Research Backgrounds
Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro-oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram-positive bacteria.
The intrachain disulfide-bonds prevent N-glycosylation at some sites.
N-glycosylated.
Cell membrane>Lipid-anchor. Cell membrane>Single-pass type II membrane protein. Membrane raft. Secreted.
Note: A secreted form also exists. Localization to membrane rafts requires palmitoylation.
Expressed at high level in endothelial cells and vascular-rich organs such as placenta, lung, liver and brain, aortic intima, bone marrow, spinal cord and substantia nigra. Also expressed at the surface of dendritic cells. Widely expressed at intermediate and low level.
The cytoplasmic region is required for subcellular sorting on the cell surface.
The C-type lectin domain mediates the recognition and binding of oxLDL.
Research Fields
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
· Organismal Systems > Endocrine system > PPAR signaling pathway.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.