AFfirm™ ACTR3 Mouse Monoclonal Antibody - #BF8074

(1)  
Product: ACTR3 Mouse Monoclonal Antibody
Catalog: BF8074
Description: Mouse monoclonal antibody to ACTR3
Application: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 47kDa; 47kD(Calculated).
Uniprot: P61158

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
WB 1:1000-1:10000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFfirm8074]
Specificity:
ACTR3 Antibody detects endogenous levels of total ACTR3.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Actin like protein 3; Actin related protein 3; ACTR3; ARP3 actin related protein 3 homolog (yeast);

Immunogens

Immunogen:
Uniprot:

P61158(ARP3_HUMAN) >>Visit HPA database.

Gene(ID):
ACTR3(10096)
Description:
Actin nucleation, the formation of new actin filaments from existing filaments, affects actin filament structure during cell motility, division, and intracellular trafficking. An important actin nucleation protein complex is the highly conserved ARP2/3 complex, consisting of ARP2, ARP3, and ARPC1-5. The ARP2/3 complex promotes branching of an existing actin filament and formation of a daughter filament following activation by nucleation-promoting factors, such as WASP/WAVE or cortactin (1). The formation of podosomes, small cellular projections that degrade the extracellular matrix, is enhanced by ARP2/3 complex action. ARP2/3 competes with caldesmon, an actin binding protein shown to negatively affect podosome formation (2). Along with N-WASP, the ARP2/3 complex regulates nuclear actin filament nucleation and controls actin polymerization during transcription (3).
Sequence:
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS

PTMs - P61158 As Substrate

Site PTM Type Enzyme
A2 Acetylation
C8 S-Nitrosylation
C12 S-Nitrosylation
Y16 Phosphorylation
K18 Ubiquitination
K38 Ubiquitination
K42 Ubiquitination
K53 Acetylation
K53 Ubiquitination
K69 Ubiquitination
K75 Ubiquitination
K99 Ubiquitination
Y100 Phosphorylation
Y109 Phosphorylation
T113 Phosphorylation
T119 Phosphorylation
S133 Phosphorylation
Y140 Phosphorylation
S152 Phosphorylation
Y184 Phosphorylation
K191 Ubiquitination
T201 Phosphorylation
Y202 Phosphorylation
K225 Ubiquitination
K228 Ubiquitination
Y231 Phosphorylation
S232 Phosphorylation
Y233 Phosphorylation
K240 Acetylation
K240 Ubiquitination
K244 Acetylation
K244 Ubiquitination
K251 Acetylation
K251 Ubiquitination
K254 Acetylation
K254 Ubiquitination
K264 Sumoylation
K264 Ubiquitination
K265 Ubiquitination
S268 Phosphorylation
K317 Ubiquitination
S322 Phosphorylation
S325 Phosphorylation
T326 Phosphorylation
K348 Ubiquitination
S350 Phosphorylation
S354 Phosphorylation
K359 Ubiquitination
K361 Ubiquitination
K398 Ubiquitination
Y400 Phosphorylation
S418 Phosphorylation

Research Backgrounds

Function:

ATP-binding component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF). The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. Seems to contact the pointed end of the daughter actin filament. In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. The Arp2/3 complex promotes homologous recombination (HR) repair in response to DNA damage by promoting nuclear actin polymerization, leading to drive motility of double-strand breaks (DSBs). Plays a role in ciliogenesis.

Subcellular Location:

Cytoplasm>Cytoskeleton. Cell projection. Nucleus.
Note: In pre-apoptotic cells, colocalizes with MEFV in large specks (pyroptosomes) (PubMed:19109554).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Component of the Arp2/3 complex composed of ACTR2/ARP2, ACTR3/ARP3, ARPC1B/p41-ARC, ARPC2/p34-ARC, ARPC3/p21-ARC, ARPC4/p20-ARC and ARPC5/p16-ARC. Interacts with WHDC1. Interacts weakly with MEFV.

Family&Domains:

Belongs to the actin family. ARP3 subfamily.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Tight junction.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.