Product: Cofilin Mouse Monoclonal Antibody
Catalog: BF8171
Description: Mouse monoclonal antibody to Cofilin
Application: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Dog
Mol.Wt.: 19kDa(Observed); 19kD(Calculated).
Uniprot: P23528

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFfirm8171]
Specificity:
Cofilin Antibody detects endogenous levels of total Cofilin.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

18 kDa phosphoprotein; CFL 1; CFL; CFL1; COF1_HUMAN; Cofilin 1; Cofilin 1 non muscle; Cofilin; Cofilin non muscle isoform; Cofilin-1; epididymis secretory protein Li 15; HEL-S-15; non-muscle isoform; p18;

Immunogens

Immunogen:

A synthesized peptide derived from human Cofilin, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P23528 COF1_HUMAN:

Widely distributed in various tissues.

Description:
cofilin 1 a cytoskeletal protein that controls actin depolymerization. Has a 5-10-fold higher affinity for ATP-actin monomers than cofilin-1. May promote filament assembly rather than disassembly. Two alternatively spliced variants are described.
Sequence:
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Research Backgrounds

Function:

Binds to F-actin and exhibits pH-sensitive F-actin depolymerizing activity. Regulates actin cytoskeleton dynamics. Important for normal progress through mitosis and normal cytokinesis. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required for the up-regulation of atypical chemokine receptor ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. Required for neural tube morphogenesis and neural crest cell migration (By similarity).

PTMs:

Inactivated by phosphorylation on Ser-3. Phosphorylated on Ser-3 in resting cells (By similarity). Dephosphorylated by PDXP/chronophin; this restores its activity in promoting actin filament depolymerization. The phosphorylation of Ser-24 may prevent recognition of the nuclear localization signal (By similarity). Phosphorylated via a ARRB1-RAC1-LIMK1-PAK1 cascade upon active ligand stimulation of atypical chemokine receptor ACKR2.

Subcellular Location:

Nucleus matrix. Cytoplasm>Cytoskeleton. Cell projection>Ruffle membrane>Peripheral membrane protein>Cytoplasmic side. Cell projection>Lamellipodium membrane>Peripheral membrane protein>Cytoplasmic side. Cell projection>Lamellipodium.
Note: Colocalizes with the actin cytoskeleton in membrane ruffles and lamellipodia. Detected at the cleavage furrow and contractile ring during cytokinesis. Almost completely in nucleus in cells exposed to heat shock or 10% dimethyl sulfoxide.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely distributed in various tissues.

Family&Domains:

Belongs to the actin-binding proteins ADF family.

Research Fields

· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Organismal Systems > Development > Axon guidance.   (View pathway)

· Organismal Systems > Immune system > Fc gamma R-mediated phagocytosis.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.