Product: CDX2 Antibody
Catalog: AF4089
Description: Rabbit polyclonal antibody to CDX2
Application: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 40kd; 34kD(Calculated).
Uniprot: Q99626
RRID: AB_2835355

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Sheep(86%), Rabbit(100%), Dog(86%), Chicken(100%)
Clonality:
Polyclonal
Specificity:
CDX2 Antibody detects endogenous levels of total CDX2.
RRID:
AB_2835355
Cite Format: Affinity Biosciences Cat# AF4089, RRID:AB_2835355.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Supplied at 1.0mg/mL in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Caudal type homeo box 2; Caudal type homeo box transcription factor 2; Caudal type homeobox 2; Caudal type homeobox protein 2; Caudal type homeobox transcription factor 2; Caudal-type homeobox protein 2; CDX 2; CDX 3; CDX-3; Cdx2; CDX2/AS; CDX2_HUMAN; CDX3; Homeobox protein CDX 2; Homeobox protein CDX-2;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
Involved in the transcriptional regulation of multiple genes expressed in the intestinal epithelium. Important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine.
Sequence:
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVPGSVPGVLGPTGGVLNPTVTQ

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Chicken
100
Rabbit
100
Sheep
86
Dog
86
Horse
0
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q99626 As Substrate

Site PTM Type Enzyme
S4 Phosphorylation
S60 Phosphorylation
S176 Phosphorylation
S226 Phosphorylation
S277 Phosphorylation
S283 Phosphorylation P24941 (CDK2) , Q16539 (MAPK14) , P49841 (GSK3B)
S287 Phosphorylation P24941 (CDK2) , Q16539 (MAPK14)
S291 Phosphorylation P24941 (CDK2) , Q16539 (MAPK14)
S295 Phosphorylation Q16539 (MAPK14)
T310 Phosphorylation
T312 Phosphorylation

Research Backgrounds

Function:

Involved in the transcriptional regulation of multiple genes expressed in the intestinal epithelium. Important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine. Binds preferentially to methylated DNA.

PTMs:

Phosphorylation of Ser-60 mediates the transactivation capacity.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the Caudal homeobox family.

Research Fields

· Human Diseases > Cancers: Specific types > Gastric cancer.   (View pathway)

References

1). Wang J et al. Moderate Treadmill Exercise Modulates Gut Microbiota and Improves Intestinal Barrier in High-Fat-Diet-Induced Obese Mice via the AMPK/CDX2 Signaling Pathway. Diabetes Metabolic Syndrome and Obesity-Target & Therapy 2022 Jan 20;15:209-223. (PubMed: 35087282) [IF=3.3]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.