Product: DLX4 Mouse Monoclonal Antibody
Catalog: BF8462
Description: Mouse monoclonal antibody to DLX4
Application: WB
Reactivity: Human, Mouse
Prediction: Bovine, Sheep, Dog
Mol.Wt.: 34 KD; 26kD(Calculated).
Uniprot: Q92988

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Monoclonal [AFfirm8462]
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Beta protein 1; BP1; Distal less homeo box 7; Distal less homeo box 9; distal-less homeobox 4; DLX4; DLX4_HUMAN; DLX7; DLX8; DLX9; Homeobox protein DLX-4; Homeobox protein DLX-7; Homeobox protein DLX-8; Homeobox protein DLX4;

Immunogens

Immunogen:

A synthesized peptide derived from human DLX4, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q92988 DLX4_HUMAN:

Expressed in leukemia cells and placenta. Also expressed in kidney and fetal liver.

Sequence:
MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM

Research Backgrounds

Function:

May play a role in determining the production of hemoglobin S. May act as a repressor. During embryonic development, plays a role in palatogenesis.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in leukemia cells and placenta. Also expressed in kidney and fetal liver.

Family&Domains:

Belongs to the distal-less homeobox family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.