AFfirm™ CD3E Mouse Monoclonal Antibody - #BF9361
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
4930549J05Rik; A430104F18Rik; AW552088; Cd247; CD247 antigen; CD247 antigen, zeta subunit; CD247 molecule; CD3; CD3 antigen, delta subunit; CD3 delta; CD3 epsilon; CD3 eta; CD3 gamma; CD3 molecule delta polypeptide; CD3 molecule, epsilon polypeptide; CD3 molecule, gamma polypeptide; CD3 zeta; CD3-DELTA; CD3d; CD3D antigen delta polypeptide; CD3d antigen, delta polypeptide (TiT3 complex); CD3d molecule delta; CD3d molecule delta CD3 TCR complex; CD3d molecule, delta (CD3-TCR complex); CD3D_HUMAN; CD3E; CD3e antigen; CD3E antigen epsilon polypeptide; CD3e antigen, epsilon polypeptide (TiT3 complex); CD3e molecule epsilon; CD3e molecule epsilon CD3 TCR complex; CD3e molecule, epsilon (CD3-TCR complex); CD3epsilon; CD3G; CD3g antigen; CD3G antigen gamma polypeptide; CD3g antigen, gamma polypeptide (TiT3 complex); CD3g molecule gamma; CD3g molecule gamma CD3 TCR complex; CD3g molecule, gamma (CD3-TCR complex); CD3H; CD3Q; CD3Z; CD3zeta; Ctg3; FLJ17620; FLJ17664; FLJ18683; FLJ79544; FLJ94613; IMD19; Leu-4; MGC138597; OKT3, delta chain; OTTHUMP00000032544; T cell receptor; T cell receptor T3 delta chain; T cell receptor T3 gamma chain; T cell receptor T3 zeta chain; T cell receptor zeta chain; T cell surface antigen T3/Leu 4 epsilon chain; T cell surface glycoprotein CD3; T cell surface glycoprotein CD3 delta chain; T cell surface glycoprotein CD3 epsilon chain; T cell surface glycoprotein CD3 gamma chain; T cell surface glycoprotein CD3 zeta chain; T-cell antigen receptor complex, delta subunit of T3; T-cell antigen receptor complex, epsilon subunit of T3; T-cell antigen receptor complex, gamma subunit of T3; T-cell antigen receptor complex, zeta subunit of CD3; T-cell receptor T3 delta chain; T-cell receptor T3 gamma chain; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 delta chain; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface glycoprotein CD3 gamma chain; T3; T3d; T3e; T3g; T3z; TCRE; TCRk; Tcrz; TCRzeta antibody
Immunogens
- P07766 CD3E_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
PTMs - P07766 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K64 | Ubiquitination | Uniprot | |
K73 | Ubiquitination | Uniprot | |
S77 | Phosphorylation | Uniprot | |
S83 | Phosphorylation | Uniprot | |
K85 | Ubiquitination | Uniprot | |
K104 | Ubiquitination | Uniprot | |
K177 | Ubiquitination | Uniprot | |
Y188 | Phosphorylation | P06239 (LCK) , P06241 (FYN) | Uniprot |
Y199 | Phosphorylation | P06241 (FYN) , P06239 (LCK) | Uniprot |
S200 | Phosphorylation | Uniprot |
Research Backgrounds
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.
Phosphorylated on Tyr residues after T-cell receptor triggering by LCK in association with CD4/CD8.
Cell membrane>Single-pass type I membrane protein.
The TCR-CD3 complex is composed of a CD3D/CD3E and a CD3G/CD3E heterodimers that preferentially associate with TCRalpha and TCRbeta, respectively, to form TCRalpha/CD3E/CD3G and TCRbeta/CD3G/CD3E trimers. In turn, the hexamer interacts with CD3Z homodimer to form the TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be replaced by TCRgamma and TCRdelta. Interacts with CD6. Interacts with NCK1. Interacts with NUMB; this interaction is important for TCR-CD3 internalization and subsequent degradation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.