Product: CD3E Mouse Monoclonal Antibody
Catalog: BF9361
Description: Mouse monoclonal antibody to CD3E
Application: WB
Reactivity: Human
Prediction: Mouse, Rat, Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 23kDa(Observed); 23kD(Calculated).
Uniprot: P07766

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse IgG
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm9361]
Specificity:
CD3 epsilon Mouse Monoclonal Antibody detects endogenous levels of total CD3.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

4930549J05Rik; A430104F18Rik; AW552088; Cd247; CD247 antigen; CD247 antigen, zeta subunit; CD247 molecule; CD3; CD3 antigen, delta subunit; CD3 delta; CD3 epsilon; CD3 eta; CD3 gamma; CD3 molecule delta polypeptide; CD3 molecule, epsilon polypeptide; CD3 molecule, gamma polypeptide; CD3 zeta; CD3-DELTA; CD3d; CD3D antigen delta polypeptide; CD3d antigen, delta polypeptide (TiT3 complex); CD3d molecule delta; CD3d molecule delta CD3 TCR complex; CD3d molecule, delta (CD3-TCR complex); CD3D_HUMAN; CD3E; CD3e antigen; CD3E antigen epsilon polypeptide; CD3e antigen, epsilon polypeptide (TiT3 complex); CD3e molecule epsilon; CD3e molecule epsilon CD3 TCR complex; CD3e molecule, epsilon (CD3-TCR complex); CD3epsilon; CD3G; CD3g antigen; CD3G antigen gamma polypeptide; CD3g antigen, gamma polypeptide (TiT3 complex); CD3g molecule gamma; CD3g molecule gamma CD3 TCR complex; CD3g molecule, gamma (CD3-TCR complex); CD3H; CD3Q; CD3Z; CD3zeta; Ctg3; FLJ17620; FLJ17664; FLJ18683; FLJ79544; FLJ94613; IMD19; Leu-4; MGC138597; OKT3, delta chain; OTTHUMP00000032544; T cell receptor; T cell receptor T3 delta chain; T cell receptor T3 gamma chain; T cell receptor T3 zeta chain; T cell receptor zeta chain; T cell surface antigen T3/Leu 4 epsilon chain; T cell surface glycoprotein CD3; T cell surface glycoprotein CD3 delta chain; T cell surface glycoprotein CD3 epsilon chain; T cell surface glycoprotein CD3 gamma chain; T cell surface glycoprotein CD3 zeta chain; T-cell antigen receptor complex, delta subunit of T3; T-cell antigen receptor complex, epsilon subunit of T3; T-cell antigen receptor complex, gamma subunit of T3; T-cell antigen receptor complex, zeta subunit of CD3; T-cell receptor T3 delta chain; T-cell receptor T3 gamma chain; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 delta chain; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface glycoprotein CD3 gamma chain; T3; T3d; T3e; T3g; T3z; TCRE; TCRk; Tcrz; TCRzeta antibody

Immunogens

Immunogen:

A synthesized peptide derived from human CD3, corresponding to a region within C-terminal amino acids.

Uniprot:
Description:
When T cells encounter antigens via the T cell receptor (TCR), information about the quantity and quality of antigens is relayed to the intracellular signal transduction machinery (1). This activation process depends mainly on CD3 (Cluster of Differentiation 3), a multiunit protein complex that directly associates with the TCR. CD3 is composed of four polypeptides: ζ, γ, ε and δ. Each of these polypeptides contains at least one immunoreceptor tyrosine-based activation motif (ITAM) (2). Engagement of TCR complex with foreign antigens induces tyrosine phosphorylation in the ITAM motifs and phosphorylated ITAMs function as docking sites for signaling molecules such as ZAP-70 and p85 subunit of PI-3 kinase (3,4). TCR ligation also induces a conformational change in CD3ε, such that a proline-region is exposed and then associates with the adapter protein Nck (5).
Sequence:
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

Research Backgrounds

Function:

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.

PTMs:

Phosphorylated on Tyr residues after T-cell receptor triggering by LCK in association with CD4/CD8.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.