TNFSF9 Antibody - #DF3178
| Product: | TNFSF9 Antibody |
| Catalog: | DF3178 |
| Description: | Rabbit polyclonal antibody to TNFSF9 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Horse |
| Mol.Wt.: | 23 KD; 27kD(Calculated). |
| Uniprot: | P41273 |
| RRID: | AB_2835401 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3178, RRID:AB_2835401.
Fold/Unfold
4 1BB L; 4 1BB ligand; 4 1BBL; 4-1BB ligand; 4-1BBL; Cd137l; Cd157l; Homolog of mouse 4 1BB L; Homolog of mouse 4 1BBL; ILA ligand (TNF related); Ly63l; Receptor 4 1BB ligand; TNF superfamily member 9; TNFL9_HUMAN; Tnfsf9; TNLG5A; Tumor necrosis factor (ligand) superfamily member 9; Tumor necrosis factor ligand 5A; Tumor necrosis factor ligand superfamily member 9; Tumor necrosis factor superfamily member 9;
Immunogens
A synthesized peptide derived from human TNFSF9, corresponding to a region within the internal amino acids.
- P41273 TNFL9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.
Membrane>Single-pass type II membrane protein.
Expressed in brain, placenta, lung, skeletal muscle and kidney.
Belongs to the tumor necrosis factor family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.