Product: 14-3-3 gamma Mouse Monoclonal Antibody
Catalog: BF9438
Description: Mouse monoclonal antibody to 14-3-3 gamma
Application: WB
Reactivity: Human
Prediction: Mouse, Rat, Pig, Bovine, Horse, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 28 KD; 28kD(Calculated).
Uniprot: P61981

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm9438]
Specificity:
14-3-3 gamma Mouse Monoclonal Antibody detects endogenous levels of total 14-3-3 gamma.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

14 3 3 gamma; 14 3 3 protein gamma; 14 3 3 protein gamma subtype; 14 3 3gamma; 14-3-3 protein gamma; 1433G_HUMAN; 3 monooxygenase/tryptophan 5 monooxgenase activation protein gamma polypeptide; KCIP 1; KCIP-1; KCIP1; N-terminally processed; Protein kinase C inhibitor protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein gamma polypeptide; Ywhag;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P61981 1433G_HUMAN:

Highly expressed in brain, skeletal muscle, and heart.

Sequence:
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN

PTMs - P61981 As Substrate

Site PTM Type Enzyme
V2 Acetylation
K10 Ubiquitination
Y20 Phosphorylation
K28 Ubiquitination
T31 Phosphorylation
S38 Phosphorylation
S46 Phosphorylation
Y49 Phosphorylation
K50 Acetylation
K50 Methylation
K50 Ubiquitination
S59 Phosphorylation Q9NRM7 (LATS2)
S65 Phosphorylation
K69 Acetylation
K69 Ubiquitination
S71 Phosphorylation
K77 Ubiquitination
K110 Ubiquitination
T115 Phosphorylation
Y117 Phosphorylation
S119 Phosphorylation
K120 Acetylation
K120 Ubiquitination
K125 Acetylation
K125 Ubiquitination
K127 Ubiquitination
Y130 Phosphorylation
Y131 Phosphorylation
Y133 Phosphorylation
T139 Phosphorylation
K142 Acetylation
K142 Ubiquitination
K152 Acetylation
K152 Ubiquitination
S155 Phosphorylation
K162 Acetylation
K162 Ubiquitination
T168 Phosphorylation
Y179 Phosphorylation
S180 Phosphorylation
K198 Ubiquitination
T199 Phosphorylation
T210 Phosphorylation
S215 Phosphorylation
Y216 Phosphorylation
S219 Phosphorylation
T220 Phosphorylation
T234 Phosphorylation
S235 Phosphorylation

Research Backgrounds

Function:

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.

PTMs:

Phosphorylated by various PKC isozymes.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in brain, skeletal muscle, and heart.

Subunit Structure:

Homodimer. Interacts with SAMSN1 (By similarity). Interacts with RAF1, SSH1 and CRTC2/TORC2. Interacts with ABL1 (phosphorylated form); the interaction retains it in the cytoplasm. Interacts with GAB2. Interacts with MDM4 (phosphorylated); negatively regulates MDM4 activity toward TP53. Interacts with PKA-phosphorylated AANAT and SIRT2.Interacts with the 'Thr-369' phosphorylated form of DAPK2. Interacts with PI4KB, TBC1D22A and TBC1D22B. Interacts with SLITRK1. Interacts with LRRK2; this interaction is dependent on LRRK2 phosphorylation. Interacts with MARK2 and MARK3.

Family&Domains:

Belongs to the 14-3-3 family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

· Cellular Processes > Cell growth and death > Oocyte meiosis.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > Hippo signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.

· Human Diseases > Cancers: Overview > Viral carcinogenesis.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.