Product: TAF15 Mouse Monoclonal Antibody
Catalog: BF9456
Description: Mouse monoclonal antibody to TAF15
Application: WB
Reactivity: Human
Prediction: Mouse, Rat, Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 70kD; 62kD(Calculated).
Uniprot: Q92804

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm9456]
Specificity:
TAF15 Mouse Monoclonal Antibody detects endogenous levels of total TAF15.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

68 kDa TATA-binding protein-associated factor; Npl3; RBP56; RBP56_HUMAN; RNA binding protein 56; RNA-binding protein 56; TAF; TAF(II)68; TAF15; TAF15 RNA polymerase II TATA box binding protein (TBP) associated factor 68kDa; TAF2N; TAFII68; TATA-binding protein-associated factor 2N;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q92804 RBP56_HUMAN:

Ubiquitous. Observed in all fetal and adult tissues.

Sequence:
MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY

PTMs - Q92804 As Substrate

Site PTM Type Enzyme
Y50 Phosphorylation
Y70 Phosphorylation
S76 Phosphorylation
S77 Phosphorylation
Y78 Phosphorylation
S79 Phosphorylation
Y83 Phosphorylation
S94 Phosphorylation
S95 Phosphorylation
S97 Phosphorylation
S104 Phosphorylation
Y110 Phosphorylation
S115 Phosphorylation
Y116 Phosphorylation
Y135 Phosphorylation
Y142 Phosphorylation
Y149 Phosphorylation
Y156 Phosphorylation
S157 Phosphorylation
T160 Phosphorylation
R164 Methylation
Y170 Phosphorylation
R175 Methylation
Y177 Phosphorylation
S180 Phosphorylation
R185 Methylation
R187 Methylation
Y190 Phosphorylation
K192 Methylation
R195 Methylation
T199 Phosphorylation
S201 Phosphorylation
S202 Phosphorylation
R206 Methylation
K210 Methylation
Y218 Phosphorylation
T222 Phosphorylation
S226 Phosphorylation
S228 Phosphorylation
S231 Phosphorylation
K261 Ubiquitination
K265 Ubiquitination
K268 Acetylation
K268 Ubiquitination
K277 Methylation
K277 Ubiquitination
S289 Phosphorylation
S295 Phosphorylation
K297 Sumoylation
K297 Ubiquitination
K306 Acetylation
K306 Ubiquitination
R320 Methylation
R321 Methylation
R326 Methylation
S330 Phosphorylation
R334 Methylation
R335 Methylation
R349 Methylation
K354 Acetylation
K354 Ubiquitination
S355 Phosphorylation
S375 Phosphorylation
R383 Methylation
S387 Phosphorylation
R388 Methylation
R395 Methylation
R397 Methylation
R403 Methylation
R415 Methylation
Y418 Phosphorylation
R422 Methylation
S423 Phosphorylation
Y427 Phosphorylation
R431 Methylation
S433 Phosphorylation
Y437 Phosphorylation
S438 Phosphorylation
R441 Methylation
S442 Phosphorylation
Y446 Phosphorylation
R450 Methylation
S451 Phosphorylation
Y455 Phosphorylation
R459 Methylation
Y463 Phosphorylation
R467 Methylation
Y471 Phosphorylation
R475 Methylation
Y479 Phosphorylation
R483 Methylation
Y486 Phosphorylation
R490 Methylation
Y494 Phosphorylation
R498 Methylation
Y501 Phosphorylation
R505 Methylation
Y508 Phosphorylation
R512 Methylation
R519 Methylation
R528 Methylation
Y531 Phosphorylation
R535 Methylation
R545 Methylation
R553 Methylation
S554 Phosphorylation
R562 Methylation
R570 Methylation
K576 Methylation
R580 Methylation
Y583 Phosphorylation
R588 Methylation
R590 Methylation

Research Backgrounds

Function:

RNA and ssDNA-binding protein that may play specific roles during transcription initiation at distinct promoters. Can enter the preinitiation complex together with the RNA polymerase II (Pol II).

PTMs:

Dimethylated by PRMT1 at Arg-206 to asymmetric dimethylarginine. The methylation may favor nuclear localization and positive regulation of TAF15 transcriptional activity.

ADP-ribosylated during genotoxic stress.

Subcellular Location:

Nucleus. Cytoplasm.
Note: Shuttles from the nucleus to the cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitous. Observed in all fetal and adult tissues.

Subunit Structure:

Belongs to the RNA polymerase II (Pol II) transcriptional multiprotein complex, together with the TATA-binding protein (TBP) and other TBP-associated factors (TAF(II)s). Binds SF1.

Family&Domains:

Belongs to the RRM TET family.

Research Fields

· Genetic Information Processing > Transcription > Basal transcription factors.

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.