Product: GSTM5 Mouse Monoclonal Antibody
Catalog: BF9523
Description: Mouse monoclonal antibody to GSTM5
Application: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 26 kDa(Observed); 26kD(Calculated).
Uniprot: P46439

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse IgG
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Monoclonal [AFfirm9523]
Specificity:
GSTM5 Mouse Monoclonal Antibody detects endogenous levels of total GSTM5.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Glutathione S alkyltransferase M5; Glutathione S aralkyltransferase M5; Glutathione S aryltransferase M5; Glutathione S transferase M5; Glutathione S transferase Mu 5; Glutathione S-transferase Mu 5; GST class mu 5; GST class-mu 5; GSTM 5; GSTM5 5; Gstm5; GSTM5-5; GSTM5_HUMAN; GTM 5; GTM5; OTTHUMP00000013359; OTTHUMP00000013361; S (hydroxyalkyl)glutathione lyase M5;

Immunogens

Immunogen:

A synthesized peptide derived from human GSTM5, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Sequence:
MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK

Research Backgrounds

Function:

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the GST superfamily. Mu family.

Research Fields

· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > Chemical carcinogenesis.

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Metabolism > Metabolism of other amino acids > Glutathione metabolism.

· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - cytochrome P450.

· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.