HINT1 Antibody - #DF3191
| Product: | HINT1 Antibody |
| Catalog: | DF3191 |
| Description: | Rabbit polyclonal antibody to HINT1 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Rabbit, Xenopus |
| Mol.Wt.: | 28 KD; 14kD(Calculated). |
| Uniprot: | P49773 |
| RRID: | AB_2835414 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3191, RRID:AB_2835414.
Fold/Unfold
Adenosine 5' monophosphoramidase; Adenosine 5''-monophosphoramidase; HINT 1; HINT1; HINT1_HUMAN; Histidine triad nucleotide binding protein 1; Histidine triad nucleotide-binding protein 1; PKCI 1; PKCI-1; PKCI1; PRKCNH1; Protein kinase C inhibitor 1; Protein kinase C interacting protein 1; Protein kinase C-interacting protein 1;
Immunogens
- P49773 HINT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P49773 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| K7 | Acetylation | Uniprot | |
| K7 | Ubiquitination | Uniprot | |
| K21 | Acetylation | Uniprot | |
| K21 | Methylation | Uniprot | |
| K21 | Ubiquitination | Uniprot | |
| K30 | Acetylation | Uniprot | |
| K30 | Ubiquitination | Uniprot | |
| R37 | Methylation | Uniprot | |
| S45 | Phosphorylation | Uniprot | |
| S72 | Phosphorylation | Uniprot | |
| K82 | Ubiquitination | Uniprot | |
| K83 | Ubiquitination | Uniprot | |
| K92 | Ubiquitination | Uniprot | |
| Y94 | Phosphorylation | Uniprot | |
| S102 | Phosphorylation | Uniprot | |
| S107 | Phosphorylation | Uniprot | |
| Y109 | Phosphorylation | Uniprot |
Research Backgrounds
Hydrolyzes purine nucleotide phosphoramidates with a single phosphate group, including adenosine 5'monophosphoramidate (AMP-NH2), adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate). Hydrolyzes lysyl-AMP (AMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) generated by lysine tRNA ligase, as well as Met-AMP, His-AMP and Asp-AMP, lysyl-GMP (GMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) and AMP-N-alanine methyl ester. Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sulfide. In addition, functions as scaffolding protein that modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1. Modulates p53/TP53 levels and p53/TP53-mediated apoptosis. Modulates proteasomal degradation of target proteins by the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex.
Cytoplasm. Nucleus.
Note: Interaction with CDK7 leads to a more nuclear localization.
Widely expressed.
Homodimer. Interacts with CDK7. Interacts with RUVBL1 and RUVBL2 and is associated with the LEF1/TCF1-CTNNB1 complex and with a KAT5 histone acetyltransferase complex. Identified in a complex with MITF and CTNNB1. Interacts with CDC34 and RBX1, and is part of a SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex.
Belongs to the HINT family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.