Product: UBE2N Mouse Monoclonal Antibody
Catalog: BF9606
Description: Mouse monoclonal antibody to UBE2N
Application: WB
Reactivity: Human, Rat
Prediction: Bovine, Sheep, Rabbit, Dog, Xenopus
Mol.Wt.: 17 kDa; 17kD(Calculated).
Uniprot: P61088

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Clonality:
Monoclonal [AFfirm9606]
Specificity:
UBE2N Mouse Monoclonal Antibody detects endogenous levels of total UBE2N.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Bendless like ubiquitin conjugating enzyme; Bendless-like ubiquitin-conjugating enzyme; BLU; EC 6.3.2.19; Epididymis secretory protein Li 71; HEL-S-71; Human epidermoid carcinoma mRNA for ubiquitin-conjugating enzyme E2 similar to Drosophila bendless gene product complete cds; MGC131857; MGC8489; UBC 13; Ubc13; UbCH ben; UbcH-ben; UbcH13; UBCHBEN; Ube 2N; Ube2n; UBE2N_HUMAN; Ubiquitin carrier protein N; Ubiquitin conjugating enzyme E2 N; Ubiquitin conjugating enzyme E2N (homologous to yeast UBC13); Ubiquitin conjugating enzyme E2N (UBC13 homolog yeast); Ubiquitin conjugating enzyme E2N; Ubiquitin protein ligase N; Ubiquitin-conjugating enzyme E2 N; Ubiquitin-protein ligase N; Yeast UBC13 homolog;

Immunogens

Immunogen:

A synthesized peptide derived from human UBE2N, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI

Research Backgrounds

Function:

The UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains. This type of polyubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Acts together with the E3 ligases, HLTF and SHPRH, in the 'Lys-63'-linked poly-ubiquitination of PCNA upon genotoxic stress, which is required for DNA repair. Appears to act together with E3 ligase RNF5 in the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes. Together with RNF135 and UB2V1, catalyzes the viral RNA-dependent 'Lys-63'-linked polyubiquitination of RIG-I/DDX58 to activate the downstream signaling pathway that leads to interferon beta production.

PTMs:

Conjugation to ISG15 impairs formation of the thioester bond with ubiquitin but not interaction with UBE2V2.

Subcellular Location:

Nucleus. Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the ubiquitin-conjugating enzyme family.

Research Fields

· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.