KLF11 Antibody - #AF0315
Product: | KLF11 Antibody |
Catalog: | AF0315 |
Description: | Rabbit polyclonal antibody to KLF11 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 55kDa; 55kD(Calculated). |
Uniprot: | O14901 |
RRID: | AB_2833479 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0315, RRID:AB_2833479.
Fold/Unfold
9830142A17; D12Ertd427e; FKLF; FKLF1; Klf11; KLF11_HUMAN; Krueppel like factor 11; Krueppel-like factor 11; Krueppel-like transcription factor 1; MODY7; Tcfcp2l2; TGFB Early Growth Response 2; TGFB-inducible early growth response protein 2; TGFB-inducible early growth response protein 2b; TGFB-inducible early growth response protein 3; TIEG 2; TIEG-2; TIEG-3; Tieg2b; Transforming Growth Factor Beta Inducible Early Growth Response 2; Transforming growth factor-beta-inducible early growth response protein 2; Transforming growth factor-beta-inducible early growth response protein 3;
Immunogens
- O14901 KLF11_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MHTPDFAGPDDARAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTRTPVSPQVTDSKACTATDVLQSSAVVARALSGGAERGLLGLEPVPSSPCRAKGTSVIRHTGESPAACFPTIQTPDCRLSDSREGEEQLLGHFETLQDTHLTDSLLSTNLVSCQPCLHKSGGLLLTDKGQQAGWPGAVQTCSPKNYENDLPRKTTPLISVSVPAPPVLCQMIPVTGQSSMLPAFLKPPPQLSVGTVRPILAQAAPAPQPVFVGPAVPQGAVMLVLPQGALPPPAPCAANVMAAGNTKLLPLAPAPVFITSSQNCVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA
PTMs - O14901 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T73 | Phosphorylation | Uniprot | |
T82 | Phosphorylation | Uniprot | |
T83 | Phosphorylation | Uniprot | |
T107 | Phosphorylation | Uniprot | |
S111 | Phosphorylation | Uniprot | |
S124 | Phosphorylation | Uniprot | |
S150 | Phosphorylation | Uniprot | |
S166 | Phosphorylation | Uniprot | |
K403 | Ubiquitination | Uniprot | |
K412 | Sumoylation | Uniprot | |
K412 | Ubiquitination | Uniprot | |
T417 | Phosphorylation | Uniprot | |
T419 | Phosphorylation | Uniprot | |
T447 | Phosphorylation | Uniprot | |
T449 | Phosphorylation | Uniprot | |
K471 | Ubiquitination | Uniprot |
Research Backgrounds
Transcription factor. Activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth. Represses transcription of SMAD7 which enhances TGF-beta signaling (By similarity). Induces apoptosis (By similarity).
Nucleus.
Ubiquitous. Higher expression in erythroid cells.
Interacts with SIN3A.
Belongs to the Sp1 C2H2-type zinc-finger protein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.