Product: KLF11 Antibody
Catalog: AF0315
Description: Rabbit polyclonal antibody to KLF11
Application: WB IHC IF/ICC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 55kDa; 55kD(Calculated).
Uniprot: O14901
RRID: AB_2833479

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
KLF11 Antibody detects endogenous levels of total KLF11.
RRID:
AB_2833479
Cite Format: Affinity Biosciences Cat# AF0315, RRID:AB_2833479.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

9830142A17; D12Ertd427e; FKLF; FKLF1; Klf11; KLF11_HUMAN; Krueppel like factor 11; Krueppel-like factor 11; Krueppel-like transcription factor 1; MODY7; Tcfcp2l2; TGFB Early Growth Response 2; TGFB-inducible early growth response protein 2; TGFB-inducible early growth response protein 2b; TGFB-inducible early growth response protein 3; TIEG 2; TIEG-2; TIEG-3; Tieg2b; Transforming Growth Factor Beta Inducible Early Growth Response 2; Transforming growth factor-beta-inducible early growth response protein 2; Transforming growth factor-beta-inducible early growth response protein 3;

Immunogens

Immunogen:

A synthesized peptide derived from human KLF11, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
O14901 KLF11_HUMAN:

Ubiquitous. Higher expression in erythroid cells.

Description:
TIEG2 Transcription factor. Activates the epsilon- and gamma- globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth. Represses transcription of SMAD7 which enhances TGF-beta signaling.
Sequence:
MHTPDFAGPDDARAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTRTPVSPQVTDSKACTATDVLQSSAVVARALSGGAERGLLGLEPVPSSPCRAKGTSVIRHTGESPAACFPTIQTPDCRLSDSREGEEQLLGHFETLQDTHLTDSLLSTNLVSCQPCLHKSGGLLLTDKGQQAGWPGAVQTCSPKNYENDLPRKTTPLISVSVPAPPVLCQMIPVTGQSSMLPAFLKPPPQLSVGTVRPILAQAAPAPQPVFVGPAVPQGAVMLVLPQGALPPPAPCAANVMAAGNTKLLPLAPAPVFITSSQNCVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA

Research Backgrounds

Function:

Transcription factor. Activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth. Represses transcription of SMAD7 which enhances TGF-beta signaling (By similarity). Induces apoptosis (By similarity).

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitous. Higher expression in erythroid cells.

Family&Domains:

Belongs to the Sp1 C2H2-type zinc-finger protein family.

References

1). Ferroptosis inhibitor alleviates sorafenib-induced cardiotoxicity by attenuating KLF11-mediated FSP1-dependent ferroptosis. International journal of biological sciences, 2024 (PubMed: 38725840) [IF=8.2]

2). KLF11 regulates lung adenocarcinoma ferroptosis and chemosensitivity by suppressing GPX4. Communications Biology, 2023 (PubMed: 37248295) [IF=5.9]

Application: WB    Species: Human    Sample: A549 and PC9 cell

Fig. 1: Identification of KLF11 as involved in ferroptosis in LUAD. a Schematic diagram of RNA-seq screening workflow in A549 cell line. b, c Volcano plot illustrating KLF11 involved in regulating ferroptosis induced by RSL3 and IKE. d, e KLF11 RNA level was measured after treatment with RSL3 or DFO + RSL3 or Ferr1 + RSL3 in A549 and PC9 cell lines. f, g KLF11 protein level was measured after treatment with RSL3 or DFO + RSL3 or Ferr1 + RSL3 in A549 and PC9 cell lines.

3). The induction of ferroptosis by KLF11/NCOA4 axis: the inhibitory role in clear cell renal cell carcinoma. Human cell, 2023 (PubMed: 37642832) [IF=3.4]

4). Effects of KLF11 on Vascular Smooth Muscle Cells and its Underlying Mechanisms in Intracranial Aneurysm. Biochemical genetics, 2024 (PubMed: 38368567) [IF=2.1]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.