TUSC2 Antibody - #DF3050
Product: | TUSC2 Antibody |
Catalog: | DF3050 |
Description: | Rabbit polyclonal antibody to TUSC2 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Bovine, Horse, Rabbit, Dog |
Mol.Wt.: | 12 KD; 12kD(Calculated). |
Uniprot: | O75896 |
RRID: | AB_2835433 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3050, RRID:AB_2835433.
Fold/Unfold
C3orf11; Fus-1 protein; FUS1; Fusion 1 protein; LGCC; PAP; PDAP2; PDGFA associated protein 2; PDGFA-associated protein 2; Tumor suppressor candidate 2; TUSC 2; Tusc2; TUSC2_HUMAN;
Immunogens
A synthesized peptide derived from human TUSC2, corresponding to a region within the internal amino acids.
Strong expression in heart, lung, skeletal muscle, kidney, and pancreas, followed by brain and liver, lowest levels in placenta.
- O75896 TUSC2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells.
Myristoylation is required for tumor suppressor activity.
Strong expression in heart, lung, skeletal muscle, kidney, and pancreas, followed by brain and liver, lowest levels in placenta.
Belongs to the TUSC2 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.