AFfirm™ SM22 alpha Mouse Monoclonal Antibody - #BF9680
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
22 kDa actin binding protein; 22 kDa actin-binding protein; Human 22kDa smooth muscle protein; Protein WS3-10; SM22 alpha; SM22; SM22-alpha; SMCC; Smooth muscle protein 22-alpha; TAGL_HUMAN; TAGLN; TAGLN1; Transgelin; Transgelin variant 2; WS3 10;
Immunogens
A synthesized peptide derived from human SM22 aphla, corresponding to a region within C-terminal amino acids.
- Q01995 TAGL_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Research Backgrounds
Actin cross-linking/gelling protein (By similarity). Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.
Cytoplasm.
Belongs to the calponin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.