TACD2 Antibody - #DF3080
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3080, RRID:AB_2835463.
Fold/Unfold
Cell surface glycoprotein Trop 2; Cell surface glycoprotein Trop-2; Cell surface glycoprotein Trop2; Epithelial glycoprotein 1; GA733 1; GA7331; M1S 1; M1S1; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733 1; Pancreatic carcinoma marker protein GA733-1; Pancreatic carcinoma marker protein GA7331; TACD 2; TACD2_HUMAN; TACSTD 2; Tacstd2; Trop 2; Trop2; Tumor associated calcium signal transducer 2 precursor; Tumor-associated calcium signal transducer 2;
Immunogens
- P09758 TACD2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P09758 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S93 | O-Glycosylation | Uniprot | |
| S130 | Phosphorylation | Uniprot | |
| K212 | Acetylation | Uniprot | |
| Y224 | Phosphorylation | Uniprot | |
| Y225 | Phosphorylation | Uniprot | |
| Y259 | Phosphorylation | Uniprot | |
| S303 | Phosphorylation | P17252 (PRKCA) | Uniprot |
| K312 | Ubiquitination | Uniprot | |
| K319 | Ubiquitination | Uniprot | |
| S322 | Phosphorylation | Uniprot |
Research Backgrounds
May function as a growth factor receptor.
The N-terminus is blocked.
Membrane>Single-pass type I membrane protein.
Placenta, pancreatic carcinoma cell lines.
Belongs to the EPCAM family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.