HOXB9 Antibody - #DF3103
Product: | HOXB9 Antibody |
Catalog: | DF3103 |
Description: | Rabbit polyclonal antibody to HOXB9 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 28 KD; 28kD(Calculated). |
Uniprot: | P17482 |
RRID: | AB_2835480 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3103, RRID:AB_2835480.
Fold/Unfold
Homeo box 2E; Homeo box B9; Homeobox B9; Homeobox protein Hox B9; Homeobox protein Hox-2.5; Homeobox protein Hox-2E; Homeobox protein Hox-B9; Hox 2.5; Hox 2E; HOX2; HOX2E; Hoxb9; HXB9_HUMAN; OTTHUMP00000216946; OTTHUMP00000243325;
Immunogens
- P17482 HXB9_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P17482 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K27 | Acetylation | Uniprot | |
S30 | Phosphorylation | Uniprot | |
Y33 | Phosphorylation | Uniprot | |
S35 | Phosphorylation | Uniprot | |
S36 | Phosphorylation | Uniprot | |
R93 | Methylation | Uniprot | |
R96 | Methylation | Uniprot | |
K117 | Acetylation | Uniprot | |
T133 | Phosphorylation | Uniprot | |
S137 | Phosphorylation | Uniprot | |
R183 | Methylation | Uniprot | |
Y192 | Phosphorylation | Uniprot | |
K239 | Acetylation | Uniprot | |
K241 | Acetylation | Uniprot | |
K242 | Acetylation | Uniprot |
Research Backgrounds
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Nucleus.
Belongs to the Abd-B homeobox family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.