Product: ATF3 Antibody
Catalog: DF3110
Description: Rabbit polyclonal antibody to ATF3
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 21~25 KD; 21kD(Calculated).
Uniprot: P18847
RRID: AB_2835487

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
ATF3 Antibody detects endogenous levels of total ATF3.
RRID:
AB_2835487
Cite Format: Affinity Biosciences Cat# DF3110, RRID:AB_2835487.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Activating transcription factor 3; ATF3; ATF3_HUMAN; ATF3deltaZip2; ATF3deltaZip2c; ATF3deltaZip3; cAMP dependent transcription factor ATF3; cAMP-dependent transcription factor ATF-3; Cyclic AMP dependent transcription factor ATF3; Cyclic AMP-dependent transcription factor ATF-3;

Immunogens

Immunogen:

A synthesized peptide derived from human ATF3, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Sequence:
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Chicken
100
Rabbit
100
Zebrafish
73
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the bZIP family. ATF subfamily.

Research Fields

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

References

1). Piezo1 Upregulation in Monocyte-Derived Macrophages Impairs Post-Myocardial Infarction Cardiac Repair via Defective Efferocytosis and Enhanced Ferroptosis. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2025 (PubMed: 41214880) [IF=15.1]

Application: WB    Species: Mouse    Sample:

Figure 6 Piezo1 increased SLC7A11 in a Ca2+/ATF4-dependent manner and increased SLC15A3 in a Ca2+-dependent manner in macrophages. A) Heatmap of the genes of interest (the same as the 17 genes that were upregulated and the 17 genes that were downregulated by Yoda1 shown in Figure 5) identified by a new RNA-seq analysis of Piezo1fl/fl and Piezo1Lyz2 BMDMs, which were treated with DMSO or Yoda1 (5 µm) for 12 h. B) Levels of Atf4, Atf3, Nrf2 and P53 mRNAs in BMDMs after treatment with DMSO or Yoda1 (n = 6). C,D) Representative Western blots and quantification of the protein levels of ATF4, ATF3, NRF2 and P53 in BMDMs (n = 3). E) Representative images of immunofluorescence staining showing the ATF4 level and location in BMDMs treated with DMSO or Yoda1. F) Protein expression of ATF4 in the cytoplasm and nucleus of BMDMs treated with DMSO or Yoda1. G–I) Representative Western blots and quantification of ATF4 and SLC7A11 protein levels in BMDMs after control or Atf4 siRNA transfection and DMSO or Yoda1 treatment (n = 3). J) Flow cytometry analysis of intracellular Ca2+ levels by Fluo-4 staining in BMDMs from Piezo1fl/fl and Piezo1Lyz2 mice treated with DMSO or Yoda1 for 30 min (n = 5 mice per group). K) Fluo-4 fluorescence signals in BMDMs pretreated with 5 µM BAPTA-AM for 24 h followed by DMSO or 5 µm Yoda1 for 30 min were analyzed via flow cytometry (n = 3). L–O) Representative Western blots and quantification of the protein levels of ATF4, SLC7A11 and SLC15A3 in BMDMs (n = 3). The data in (B and D) were analyzed by unpaired Student's t test. Other data were analyzed by one-way ANOVA, followed by the Bonferroni post hoc correction.

2). A novel lncRNA SNHG29 regulates EP300- related histone acetylation modification and inhibits FLT3-ITD AML development. Leukemia, 2023 (PubMed: 37157016) [IF=12.8]

3). Macrophages originated IL-33/ST2 inhibits ferroptosis in endometriosis via the ATF3/SLC7A11 axis. Cell death & disease, 2023 (PubMed: 37816731) [IF=8.1]

4). Transcriptome analysis reveals the efficacy of ginsenoside-Rg1 in the treatment of nonalcoholic fatty liver disease. Life Sciences, 2021 (PubMed: 33385408) [IF=5.2]

Application: WB    Species: rat    Sample: liver tissue

Fig. 5. A) The protein expression levels of ATF3 and ACOX in rat liver of different groups. B) Atf3 relative protein expression level C) Acox2 relative protein expression level (*p < 0.05, **p < 0.01, ***p < 0.001, compare to NAFLD model group, SNK-Q test, n=10).

5). Atf3 + senescent chondrocytes mediate meniscus degeneration in aging. Arthritis research & therapy, 2025 (PubMed: 40375324) [IF=4.9]

Application: IHC    Species: Mouse    Sample:

Fig. 4 The Atf3 + subset identified as a senescent chondrocyte population. (A, B) Gene Ontology(A) enrichment and KEGG analysis(B) for differentially expressed genes in Atf3 + chondrocytes of meniscus. X-axis:–log10(p-value);p 

6). Blocking of FGFR4 signaling by F30 inhibits hepatocellular carcinoma cell proliferation through HMOX1-dependent ferroptosis pathway. European journal of pharmacology, 2024 (PubMed: 38484925) [IF=4.2]

7). Proteotranscriptomics Analysis Reveals the Key Pathways and Genes Involved in Apigenin's Anti-Liver Fibrosis Effects. Journal of proteome research, 2025 (PubMed: 40397522) [IF=3.8]

8). Mechanism of Saikosaponin D in regulating ferroptosis in patient-derived lung adenocarcinoma organoids via upregulation of ATF3/CHOP/CHAC1 signaling. Scientific reports, 2026 (PubMed: 41620478) [IF=3.8]

9). Src-IL-18 signaling regulates the secretion of atrial natriuretic factor in hypoxic beating rat atria. Kardiologia Polska, 2021 (PubMed: 34176112) [IF=3.7]

10). ATF3 suppresses 3T3-L1 adipocyte adipogenesis by transcriptionally repressing USP53. Journal of molecular endocrinology, 2025 (PubMed: 39641389) [IF=3.6]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.