ATF3 Antibody - #DF3110

Product: | ATF3 Antibody |
Catalog: | DF3110 |
Description: | Rabbit polyclonal antibody to ATF3 |
Application: | WB IHC IF/ICC |
Cited expt.: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 21~25 KD; 21kD(Calculated). |
Uniprot: | P18847 |
RRID: | AB_2835487 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3110, RRID:AB_2835487.
Fold/Unfold
Activating transcription factor 3; ATF3; ATF3_HUMAN; ATF3deltaZip2; ATF3deltaZip2c; ATF3deltaZip3; cAMP dependent transcription factor ATF3; cAMP-dependent transcription factor ATF-3; Cyclic AMP dependent transcription factor ATF3; Cyclic AMP-dependent transcription factor ATF-3;
Immunogens
A synthesized peptide derived from human ATF3, corresponding to a region within C-terminal amino acids.
- P18847 ATF3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.
Nucleus.
Belongs to the bZIP family. ATF subfamily.
Research Fields
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
References
Application: WB Species: rat Sample: liver tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.