Product: ATF3 Antibody
Catalog: DF3110
Description: Rabbit polyclonal antibody to ATF3
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 21 KD; 21kD(Calculated).
Uniprot: P18847
RRID: AB_2835487

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Clonality:
Polyclonal
Specificity:
ATF3 Antibody detects endogenous levels of total ATF3.
RRID:
AB_2835487
Cite Format: Affinity Biosciences Cat# DF3110, RRID:AB_2835487.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Activating transcription factor 3; ATF3; ATF3_HUMAN; ATF3deltaZip2; ATF3deltaZip2c; ATF3deltaZip3; cAMP dependent transcription factor ATF3; cAMP-dependent transcription factor ATF-3; Cyclic AMP dependent transcription factor ATF3; Cyclic AMP-dependent transcription factor ATF-3;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Sequence:
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Xenopus
100
Chicken
100
Rabbit
100
Zebrafish
73
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P18847 As Substrate

Site PTM Type Enzyme
K42 Sumoylation
R46 Methylation
K52 Ubiquitination
S60 Phosphorylation
K120 Ubiquitination
K129 Ubiquitination
T162 Phosphorylation
K175 Ubiquitination

Research Backgrounds

Function:

This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Binds DNA as a homodimer or a heterodimer.

Family&Domains:

Belongs to the bZIP family. ATF subfamily.

Research Fields

· Human Diseases > Infectious diseases: Viral > HTLV-I infection.

References

1). A novel lncRNA SNHG29 regulates EP300- related histone acetylation modification and inhibits FLT3-ITD AML development. Leukemia (PubMed: 37157016) [IF=11.4]

2). Transcriptome analysis reveals the efficacy of ginsenoside-Rg1 in the treatment of nonalcoholic fatty liver disease. Life Sciences (PubMed: 33385408) [IF=6.1]

Application: WB    Species: rat    Sample: liver tissue

Fig. 5. A) The protein expression levels of ATF3 and ACOX in rat liver of different groups. B) Atf3 relative protein expression level C) Acox2 relative protein expression level (*p < 0.05, **p < 0.01, ***p < 0.001, compare to NAFLD model group, SNK-Q test, n=10).

3). NOX4 stimulates ANF secretion via activation of the Sirt1/Nrf2/ATF3/4 axis in hypoxic beating rat atria. Molecular Medicine Reports (PubMed: 35029280) [IF=3.4]

4). Src-IL-18 signaling regulates the secretion of atrial natriuretic factor in hypoxic beating rat atria. Kardiologia Polska (PubMed: 34176112) [IF=3.3]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.