NFYA Antibody - #DF3125

Product: | NFYA Antibody |
Catalog: | DF3125 |
Description: | Rabbit polyclonal antibody to NFYA |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 43 KD; 37kD(Calculated). |
Uniprot: | P23511 |
RRID: | AB_2835502 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3125, RRID:AB_2835502.
Fold/Unfold
CAAT box DNA binding protein subunit A; CAAT box DNA-binding protein subunit A; CBF A; CBF B; CBFA; CBFB; CCAAT binding transcription factor subunit B; FLJ11236; HAP 2; HAP2; HAP2 CCAAT binding protein; NF YA; NF-YA; NFY protein chain A; NFYA; NFYA_HUMAN; NUCLEAR FACTOR BINDING TO Y BOX OF HLA GENES; Nuclear transcription factor Y alpha; Nuclear transcription factor Y; Nuclear transcription factor Y subunit A; Nuclear transcription factor Y subunit alpha; Sez10; Transcription factor NF Y A subunit;
Immunogens
A synthesized peptide derived from human NFYA, corresponding to a region within C-terminal amino acids.
- P23511 NFYA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors. NF-YA positively regulates the transcription of the core clock component ARNTL/BMAL1.
Nucleus.
Belongs to the NFYA/HAP2 subunit family.
Research Fields
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Organismal Systems > Immune system > Antigen processing and presentation. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.