GAP43 Recombinant Rabbit mAb - #BF3344

Copy Info
Product: GAP43 Recombinant Rabbit mAb
Catalog: BF3344
Description: Rabbit monoclonal antibody to GAP43
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 35-43kD(Observed); 25kD(Calculated).
Uniprot: P17677

View similar products>>

   Size Price Inventory
 100ul $280 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Control Products
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit IgG
Application:
WB 1:1000, IHC 1:500-1:2000, IF/ICC 1:100-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [ReFirm22791]
Specificity:
GAP43 Recombinant Rabbit mAb detects endogenous levels of GAP43.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Rabbit IgG in Tris-Glycine (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Axonal membrane protein GAP 43; Axonal membrane protein GAP-43; B 50; Calmodulin binding protein P 57; F1; GAP 43; GAP43; Growth Associated Protein 43; Growth-associated protein 43; Nerve Growth Related Peptide; Nerve growth related peptide GAP43; NEUM_HUMAN; Neural phosphoprotein B 50; Neural phosphoprotein B-50; Neuromodulin; Neuron growth associated protein 43; PP46; Protein F1; QtrA-11580; QtrA-13071;

Immunogens

Immunogen:

A synthetic peptide from human GAP43

Uniprot:

P17677(NEUM_HUMAN) >>Visit HPA database.

Gene(ID):
GAP43(2596)
Description:
The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Sequence:
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA

Research Backgrounds

Function:

This protein is associated with nerve growth. It is a major component of the motile 'growth cones' that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction.

PTMs:

Phosphorylated (By similarity). Phosphorylation of this protein by a protein kinase C is specifically correlated with certain forms of synaptic plasticity (By similarity).

Palmitoylation by ARF6 is essential for plasma membrane association and axonal and dendritic filopodia induction. Deacylated by LYPLA2.

Subcellular Location:

Cell membrane>Peripheral membrane protein>Cytoplasmic side. Cell projection>Growth cone membrane>Peripheral membrane protein>Cytoplasmic side. Cell junction>Synapse. Cell projection>Filopodium membrane>Peripheral membrane protein. Perikaryon. Cell projection>Dendrite. Cell projection>Axon. Cytoplasm.
Note: Cytoplasmic surface of growth cone and synaptic plasma membranes.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the neuromodulin family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.